HORDB

ID: hor007114
Uniprot ID: Q03288??24-131)
Protein name: Agouti-signaling protein
Gene name: REG3G; PAP1B;
Organism: Mus musculus
Family: NA
Source: Animal
Expression: Epithelial cells of the hair follicles and the epidermis.
Disease: NA
Comments: NA
Taxonomy: Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
GO MF: GO:0005615 extracellular space
GO BP: GO:0005184 neuropeptide hormone activity; GO:0031779 melanocortin receptor binding; GO:0031782 type 4 melanocortin receptor binding; GO:0031781 type 3 melanocortin receptor binding
GO CC: GO:0048023 positive regulation of melanin biosynthetic process; GO:0008343 adult feeding behavior; GO:0044725 epigenetic programming in the zygotic pronuclei; GO:0040029 epigenetic regulation of gene expression; GO:0006091 generation of precursor metabolites and energy; GO:0009755 hormone-mediated signaling pathway; GO:0042438 melanin biosynthetic process; GO:0043473 pigmentation; GO:0032402 melanosome transport; GO:0032438 melanosome organization

Sequence: LALEETLGDDRSLRSNSSMNSLDFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAPACCDPCASCQCRFFGSACTCRVLNPNC
Length: 108
Propeptide: MDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSLDFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAPACCDPCASCQCRFFGSACTCRVLNPNC
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

Mass:		Formula:
Absent amino acids:		Common amino acids:
pI:		Basic residues:
Polar residues:		Hydrophobic residues:
Hydrophobicity:		Boman Index:
Half-Life:		Half-Life Yeast:
Half-Life E.Coli:		Aliphatic Index
Instability Index:		Extinction Coefficient cystines:
Absorbance 280nm: